Pencirian secara berkomputer retrovirus endogenus piscin daripada pengkalan data projek genom zebrafish

Mohd Faris Abtholuddin, (2006) Pencirian secara berkomputer retrovirus endogenus piscin daripada pengkalan data projek genom zebrafish. Universiti Malaysia Sabah. (Unpublished)


Download (2MB) | Preview


Dalam kajian ini satu jujukan lengkap genom retrovirus endogenus ikan telah diperolehi darlpada pengkalan data projek genom zebrafish. Jujukan lengkap ini diperoJehi darijujukan nombor akses CR 792423.5. Klon CH21l-190Hl0 mempunyai struktur organisasi LTR-gag, pol, env-LTR yang mempunyai jujukan retrovirus endogenus. Pada kawasan gag terdapat gen Kapsid; dan mempunyai motif KQGAIEVEETEEDKKQRQL. Pada kawasan pol, terdapat empat gen di dalamnya iaitu Protease (GTDL), Transkriptase berbalik (WNTP, HDLR, NAFF, FAF, LPGQ, YVDD), RNaseH (SAQRAE, DSAY, FVTSSG, GNEAADAA) dan Integrase iaitu motif jejari zink dan motif domain teras katalisis (HSLAHSSEKDMTKRVSQWWHPFMPHMISGVIASCQTC dan DFTDMIT RVNGKRYLLVLVDQFTGWPEAFPCAREDAVSVVKCLINQYIPRHGFPRIIRSDN GTHFKNEHLADVEKLLGLKHRYGA VYHPQSQGKVE). Pada kawasan env pula, terdapat dua gen iaitu protein SU yang mengkodkan motif isyarat glikolasi dan Transmembran yang mengkodkan motif immunosupresif. Protein SU mempunyai motif terpelihara iaitu NLT, NCT, NKS, NYT, NLT. Manakala gen Transmembran pula mempunyai motif QNRLALDMLLSERGGVCSMFK. Kesemua gen-gen virus diatas telah disahkan motifnya melalui pencarian pfam dan penggunaan BLAST 2 Sequence untuk pencarian LTR. Sebagai kesimpulannya, seluruh genom retrovirus endogenus dalam genom zebrafish telah dijujukkan dengan saiz genomnya 9587 pasangan bes bermula dengan LTR-gag, pol, env-LTR. Saiz LTR untuk kedua-dua hujung yang diperolehi menunjukkan saiz 667 pasangan bes dan 666 pasangan bes.

Item Type: Academic Exercise
Uncontrolled Keywords: piscine endogenous retrovirus, zebrafish genome project, database, SU protein, Transmembrane, LTR
Subjects: Q Science > QA Mathematics > QA76 Computer software
Divisions: SCHOOL > School of Science and Technology
Date Deposited: 10 Feb 2014 10:27
Last Modified: 11 Oct 2017 05:11

Actions (login required)

View Item View Item