Pencirian berdasarkan komputer retrovirus endogenous manusia daripada pangkalan data projek genom manusia

Mohd Hafiz Shaukat Mohd Neguib, (2006) Pencirian berdasarkan komputer retrovirus endogenous manusia daripada pangkalan data projek genom manusia. Universiti Malaysia Sabah. (Unpublished)


Download (2MB) | Preview


Dalam kajian ini, satu jujukan lengkap genom endogenus retrovirus telah diperolehi daripada pangkalan data genom manusia. Jujukan lengkap endogenus retrovirus ini diperolehi daripada jujukan dengan nombor akses gb|AF045450.1| yang terletak di kromosom 21q22.3 pada kosmid Q11M15. Saiz jujukan lengkap endogenus MSRV dianggarkan berjumlah 9.37k pasangan bes nukleotida. Jujukan endogenous retrovirus MSRV yang dijumpai dalam kajian ini mempunyai struktur organisasi seperti berikut; LTR-gag-pol-env-LTR di mana jujukan ini menyerupaijujukan kebanyakan retrovirus endogenus yang lain. LTR adalah sepanjang 355 pasangan bes nukleotida pada hujung 5' dan 367 pasangan bes nukleotida di hujung 3'. Dapat diperhatikan delesi sepanjang 12 pasangan bes di hujung 5' L TR. Keputusan BLAST2seq menunjukkan 79% homologi di antara 5' LTR dan 3' LTR. Beberapa motif terpelihara telah dijumpai di kesemua gen virus. Di kawasan gag, motif 'Major Homology Region' (MHR) dan motif 'zinc fmger' telah dijumpai dengan jujukan QGKEENPTA dan CPLCQGNHWKAHC pada kedudukan 4386 dan 4869 pasangan bes nukleotida masing-masing. Di kawasan pol, enzim protease (LLDAGA), enzim transkriptase berbalik (CMDO) dan enzim RNAseH (YTDG) telah dijumpai pada kedudukan 5021, 5870 dan 6804 pasangan bes dalam genom retrovirus. Manakala di kawasan env, gen transmembran helices telah dijumpai dengan jujukan KPKPLFLCHSA VYCPLLKWYLSSQIEPLVWVSTFFEGLHAHKN pada lokasi 8769 pasangan bes nukleotida. Kesemua gen virus di atas telah disahkan motifnya melalui kaedah BLAST kedua, Pfam dan TM Pred, manakala LTR dicari menggunakan program BLAST2seq.

Item Type: Academic Exercise
Uncontrolled Keywords: endogenous retrovirus, human genome database, chromosome, nucleotide, transmembrane gene
Subjects: Q Science > QH Natural history > QH301 Biology
Divisions: SCHOOL > School of Science and Technology
Date Deposited: 24 Mar 2014 06:01
Last Modified: 13 Oct 2017 01:35

Actions (login required)

View Item View Item